General Information

  • ID:  hor003384
  • Uniprot ID:  A0A158TFP8
  • Protein name:  Orcokinin
  • Gene name:  ORCK
  • Organism:  Cancer borealis (Jonah crab)
  • Family:  Orcokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cancer (genus), Cancridae (family), Cancroidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  NFDEIDRSSFGFN
  • Length:  13
  • Propeptide:  MTRDVICTALLLALCVMASEGAIKDTPTHPANQPDAGYPADGSAAKRFDAFTTGFGHSKRNFDEIDRSGFGFAKRNFDEIDRSGFGFAKRNFDEIDRSGFGFAKRNFDEIDRSGFGFAKRNFDEIDRSSFGFNKRNFDEIDRSSFGFVKRMLTPRDLANLYKRNFDEIDRSGFGFVRRNAE
  • Signal peptide:  MTRDVICTALLLALCVMASEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A158TFP8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003384_AF2.pdbhor003384_ESM.pdb

Physical Information

Mass: 176181 Formula: C68H94N18O24
Absent amino acids: ACHKLMPQTVWY Common amino acids: F
pI: 3.88 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 4
Hydrophobicity: -85.38 Boman Index: -4445
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 30
Instability Index: 6479.23 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  23544036
  • Title:  Comparison of NIMS and MALDI platforms for neuropeptide and lipid mass spectrometric imaging in C. borealis brain tissue.